PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00110982001
Common NameGSBRNA2T00110982001, LOC106452705
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 285aa    MW: 31090.7 Da    PI: 7.0623
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00110982001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.81.5e-3087140155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  GSBRNA2T00110982001  87 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 140
                          59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.6E-2084144IPR009057Homeodomain-like
PROSITE profilePS5129411.05984143IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-3086145IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-2488140IPR006447Myb domain, plants
PfamPF002491.0E-790139IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MREDDSDWFS RWEQDLPSPD ELIPLSQSLI SPDLALAFDI RSPGQQPLHH HQSAPPTPSQ  60
ANSSAEFAAD SSDLGGAGDE PARTLKRPRL VWTPQLHKRF VDAVAHLGIK NAVPKTIMQL  120
MSVDGLTREN VASHLQKYRL YLKRMQGGLS SGGGGGSDPA TDRLFASSPV PAHFLHPNRS  180
DHFMPSFVPI ATLQQQQQMV AAANSHLQPP QFHHRSQIAA AHFGSPTANG KFDASFLARQ  240
TQTQQRMSTT PTLHSPVSNY VEDLESANAN GGRTVLTLFP TRDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-2086145463ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00110982001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126132e-53CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013750329.10.0PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB44e-50PCL1_ARATH; Transcription factor LUX
TrEMBLA0A078EJP20.0A0A078EJP2_BRANA; BnaC05g42310D protein
STRINGBra029866.1-P1e-164(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.11e-127G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]